PDB entry 1ayg

View 1ayg on RCSB PDB site
Description: solution structure of cytochrome c-552, nmr, 20 structures
Deposited on 1997-11-04, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1ayg__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ayg_ (-)
  neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
  pqnvtdaeakqlaqwilsik