PDB entry 1ay0

View 1ay0 on RCSB PDB site
Description: identification of catalytically important residues in yeast transketolase
Deposited on 1997-11-13, released 1998-05-13
The last revision prior to the SCOP 1.69 freeze date was dated 1998-05-13, with a file datestamp of 1998-05-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ay0A (A:)
    mtqftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinr
    drfvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgq
    gisnavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnl
    iaiyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdk
    ptlikmtttigygslhagshsvagaplkaddvkqlkskfgfnpdksfvvpqevydhyqkt
    ilkpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrk
    lsetvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygireha
    mgaimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpt
    hqpietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssie
    saskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqple
    yrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaera
    qktiafykgdklisplkkaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ay0A (A:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvagaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ay0B (B:)
    mtqftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinr
    drfvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgq
    gisnavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnl
    iaiyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdk
    ptlikmtttigygslhagshsvagaplkaddvkqlkskfgfnpdksfvvpqevydhyqkt
    ilkpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrk
    lsetvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygireha
    mgaimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpt
    hqpietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssie
    saskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqple
    yrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaera
    qktiafykgdklisplkkaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ay0B (B:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvagaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf