PDB entry 1axt

View 1axt on RCSB PDB site
Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes
Deposited on 1997-10-20, released 1998-10-28
The last revision prior to the SCOP 1.59 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.2144
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axtH (H:)
    evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
    hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axtL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsygntflnwylqksgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr