PDB entry 1axd

View 1axd on RCSB PDB site
Description: structure of glutathione s-transferase-i bound with the ligand lactoylglutathione
Deposited on 1997-10-15, released 1998-10-28
The last revision prior to the SCOP 1.61 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axdA (A:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1axdB (B:)
    apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
    dlylfesraickyaarknkpellregnleeaamvdvwieveanqytaalnpilfqvlisp
    mlggttdqkvvdenleklkkvlevyearltkckylagdflsladlnhvsvtlclfatpya
    svldayphvkawwsglmerpsvqkvaalm