PDB entry 1awr

View 1awr on RCSB PDB site
Description: cypa complexed with hagpia
Class: complex (isomerase/peptide)
Keywords: complex (isomerase/peptide), cyclophilin a, hiv-1 capsid, pseudo-symmetry
Deposited on 1997-10-04, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.394
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1awra_
  • Chain 'B':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1awrb_
  • Chain 'C':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1awrc_
  • Chain 'D':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1awrd_
  • Chain 'E':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1awre_
  • Chain 'F':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1awrf_
  • Chain 'G':
    Compound: peptide from the hiv-1 capsid protein
    Database cross-references and differences (RAF-indexed):
    • PDB 1AWR (0-5)
  • Chain 'H':
    Compound: peptide from the hiv-1 capsid protein
    Database cross-references and differences (RAF-indexed):
    • PDB 1AWR (0-5)
  • Chain 'I':
    Compound: peptide from the hiv-1 capsid protein
    Database cross-references and differences (RAF-indexed):
    • PDB 1AWR (0-5)
  • Chain 'J':
    Compound: peptide from the hiv-1 capsid protein
    Database cross-references and differences (RAF-indexed):
    • PDB 1AWR (0-5)
  • Chain 'K':
    Compound: peptide from the hiv-1 capsid protein
    Database cross-references and differences (RAF-indexed):
    • PDB 1AWR (0-5)
  • Chain 'L':
    Compound: peptide from the hiv-1 capsid protein
    Database cross-references and differences (RAF-indexed):
    • PDB 1AWR (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awrA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awrB (B:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awrC (C:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awrD (D:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awrE (E:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awrF (F:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.