PDB entry 1awo

View 1awo on RCSB PDB site
Description: the solution nmr structure of abl sh3 and its relationship to sh2 in the sh(32) construct, 20 structures
Deposited on 1997-10-03, released 1998-01-28
The last revision prior to the SCOP 1.57 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1awo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1awo_ (-)
    slfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvs