PDB entry 1awd

View 1awd on RCSB PDB site
Description: ferredoxin [2fe-2s] oxidized form from chlorella fusca
Deposited on 1997-10-01, released 1998-01-14
The last revision prior to the SCOP 1.63 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.1466
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1awd__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1awd_ (-)
  ykvtlktpsgeetiecpedtyildaaeeagldlpyscragacsscagkvesgevdqsdqs
  flddaqmgkgfvltcvayptsdvtilthqeaaly