PDB entry 1avy

View 1avy on RCSB PDB site
Description: fibritin deletion mutant m (bacteriophage t4)
Class: coiled coil
Keywords: bacteriophage t4, structural protein, chaperone, bacteriophage assembly, protein folding
Deposited on 1997-09-22, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.22
AEROSPACI score: -1.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibritin
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: WAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10104 (Start-73)
      • engineered (8)
      • engineered (12)
      • engineered (15)
      • engineered (20)
      • conflict (8)
      • conflict (12)
      • conflict (15)
    Domains in SCOPe 2.07: d1avya_
  • Chain 'B':
    Compound: fibritin
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: WAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10104
      • engineered (20)
    Domains in SCOPe 2.07: d1avyb_
  • Chain 'C':
    Compound: fibritin
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: WAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10104
      • engineered (8)
      • engineered (12)
      • engineered (15)
      • engineered (20)
      • conflict (8)
      • conflict (12)
      • conflict (15)
    Domains in SCOPe 2.07: d1avyc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1avyA (A:)
    veesgltnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrk
    dgewvllstflspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avyA (A:)
    tnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvl
    lstflspa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1avyB (B:)
    veesgltnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrk
    dgewvllstflspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avyB (B:)
    vrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvllstflsp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1avyC (C:)
    veesgltnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrk
    dgewvllstflspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1avyC (C:)
    ltnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewv
    llstflsp