PDB entry 1aut

View 1aut on RCSB PDB site
Description: human activated protein c
Class: complex (blood coagulation/inhibitor)
Keywords: hydrolase, serine proteinase), plasma calcium binding, glycoprotein, complex (blood coagulation/inhibitor)
Deposited on 1996-06-08, released 1997-08-20
The last revision prior to the SCOP 1.75 freeze date was dated 1997-08-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: activated protein c
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04070 (26-148)
      • modified residue (56)
    Domains in SCOP 1.75: d1autc_
  • Chain 'L':
    Compound: activated protein c
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1autl1, d1autl2
  • Chain 'P':
    Compound: d-phe-pro-mai
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1autC (C:)
    lidgkmtrrgdspwqvvlldskkklacgavlihpswvltaahcmdeskkllvrlgeydlr
    rwekweldldikevfvhpnysksttdndiallhlaqpatlsqtivpiclpdsglaereln
    qagqetlvtgwgyhssrekeakrnrtfvlnfikipvvphnecsevmsnmvsenmlcagil
    gdrqdacegdsggpmvasfhgtwflvglvswgegcgllhnygvytkvsryldwihghird
    keapqkswap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1autC (C:)
    lidgkmtrrgdspwqvvlldskkklacgavlihpswvltaahcmdeskkllvrlgeydlr
    rwekweldldikevfvhpnysksttdndiallhlaqpatlsqtivpiclpdsglaereln
    qagqetlvtgwgyhssrekeakrnrtfvlnfikipvvphnecsevmsnmvsenmlcagil
    gdrqdacegdsggpmvasfhgtwflvglvswgegcgllhnygvytkvsryldwihghird
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1autL (L:)
    skhvdgdqclvlplehpcaslccghgtcidgigsfscdcrsgwegrfcqrevsflncsld
    nggcthycleevgwrrcscapgyklgddllqchpavkfpcgrpwkrmekkrshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1autL (L:)
    qclvlplehpcaslccghgtcidgigsfscdcrsgwegrfcqrevsflncsldnggcthy
    cleevgwrrcscapgyklgddllqchpavkfpcgrpwk
    

  • Chain 'P':
    No sequence available.