PDB entry 1aut

View 1aut on RCSB PDB site
Description: Human activated protein C
Deposited on 1996-06-08, released 1997-08-20
The last revision prior to the SCOP 1.59 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1autC (C:)
    lidgkmtrrgdspwqvvlldskkklacgavlihpswvltaahcmdeskkllvrlgeydlr
    rwekweldldikevfvhpnysksttdndiallhlaqpatlsqtivpiclpdsglaereln
    qagqetlvtgwgyhssrekeakrnrtfvlnfikipvvphnecsevmsnmvsenmlcagil
    gdrqdacegdsggpmvasfhgtwflvglvswgegcgllhnygvytkvsryldwihghird
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1autL (L:)
    qclvlplehpcaslccghgtcidgigsfscdcrsgwegrfcqrevsflncsldnggcthy
    cleevgwrrcscapgyklgddllqchpavkfpcgrpwk