PDB entry 1aus

View 1aus on RCSB PDB site
Description: activated unliganded spinach rubisco
Deposited on 1995-06-21, released 1995-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Domains in SCOP 1.59: d1ausl1, d1ausl2
  • Chain 'M':
    no info in PDB for this chain
  • Chain 'N':
    no info in PDB for this chain
  • Chain 'O':
    no info in PDB for this chain
  • Chain 'S':
    Domains in SCOP 1.59: d1auss_
  • Chain 'T':
    no info in PDB for this chain
  • Chain 'U':
    no info in PDB for this chain
  • Chain 'V':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ausL (L:)
    ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
    ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
    ipvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldf
    tkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfare
    lgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalr
    lsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvas
    ggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlar
    egntiireatkwspelaaacevwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ausL (L:)
    ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
    ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
    ipvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldf
    tkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfare
    lgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalr
    lsggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihv
    whmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregnti
    ireatkwspelaaacevwk
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ausS (S:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.