PDB entry 1aus

View 1aus on RCSB PDB site
Description: activated unliganded spinach rubisco
Class: lyase (carbon-carbon)
Keywords: lyase (carbon-carbon)
Deposited on 1995-06-21, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ausl1, d1ausl2
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ausm1, d1ausm2
  • Chain 'N':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ausn1, d1ausn2
  • Chain 'O':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1auso1, d1auso2
  • Chain 'S':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1auss_
  • Chain 'T':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1aust_
  • Chain 'U':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1ausu_
  • Chain 'V':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q43832 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1ausv_
  • Heterogens: MG, FMT, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ausL (L:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ausL (L:)
    ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
    ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
    ipvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldf
    tkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfare
    lgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalr
    lsggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihv
    whmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregnti
    ireatkwspelaaacevwk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ausM (M:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ausM (M:)
    ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
    ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
    ipvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldf
    tkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfare
    lgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalr
    lsggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihv
    whmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregnti
    ireatkwspelaaacevwk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1ausN (N:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ausN (N:)
    ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
    ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
    ipvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldf
    tkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfare
    lgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalr
    lsggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihv
    whmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregnti
    ireatkwspelaaacevwk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ausO (O:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ausO (O:)
    ykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwtdgltnldr
    ykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalralrledlr
    ipvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldf
    tkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfare
    lgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalr
    lsggdhihsgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihv
    whmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregnti
    ireatkwspelaaacevwk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ausS (S:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ausT (T:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ausU (U:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ausV (V:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy