PDB entry 1aud

View 1aud on RCSB PDB site
Description: u1a-utrrna, nmr, 31 structures
Deposited on 1997-08-22, released 1998-02-25
The last revision prior to the SCOP 1.55 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: NMR31
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1auda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1audA (A:)
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv