PDB entry 1atz

View 1atz on RCSB PDB site
Description: human von willebrand factor a3 domain
Class: collagen-binding
Keywords: collagen-binding, hemostasis, dinucleotide binding fold
Deposited on 1997-08-15, released 1998-02-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1atza_
  • Chain 'B':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1atzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1atzA (A:)
    dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
    wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
    vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
    nsflhklcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atzA (A:)
    qpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpwnv
    vpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsvds
    vdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgnsf
    lhkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1atzB (B:)
    dcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvp
    wnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvs
    vdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlg
    nsflhklcs