PDB entry 1att

View 1att on RCSB PDB site
Description: crystal structure of cleaved bovine antithrombin iii at 3.2 angstroms resolution
Deposited on 1993-03-29, released 1994-07-31
The last revision prior to the SCOP 1.71 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.212
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1atta_
  • Chain 'B':
    Domains in SCOP 1.71: d1attb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1attA (A:)
    vedvctakprdipvnpmciyrategqgseqkipgatnrrvwelskanshfatafyqhlad
    sknnndniflsplsistafamtklgacnntltqlmevfkfdtisektsdqihfffaklnc
    rlyrkanksselvsanrlfgdksitfnetyqdisevvygaklqpldfkgnaeqsrltinq
    wisnktegritdvippqaineftvlvlvntiyfkglwkskfspentrkelfykadgescs
    vlmmyqeskfryrrvaestqvlelpfkgdditmvlilpklektlakveqeltpdmlqewl
    deltetllvvhmprfriedsfsvkeqlqdmgledlfspeksrlpgivaegrsdlyvsdaf
    hkaflevneegseaaastvisiagrslrvtfkanrpflvlirevalntiifmgrvanpcv
    d
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1attB (B:)
    kprdipvnpmciyrssqkipgatnrrvwelskanshfatafyqhladsknnndniflspl
    sistafamtklgacnntltqlmevfkfdtisektsdqihfffaklncrlyrkanksselv
    sanrlfgdksitfnetyqdisevvygaklqpldfkgnaeqsrltinqwisnktegritdv
    ippqaineftvlvlvntiyfkglwkskfspentrkelfykadgescsvlmmyqeskfryr
    rvaestqvlelpfkgdditmvlilpklektlakveqeltpdmlqewldeltetllvvhmp
    rfriedsfsvkeqlqdmgledlfspeksrlpgivaegrsdlyvsdafhkaflevneegse
    aaastvisiagrslnsdrvtfkanrpflvlirevalntiifmgrvanpcvd