PDB entry 1att

View 1att on RCSB PDB site
Description: crystal structure of cleaved bovine antithrombin III at 3.2 angstroms resolution
Class: serine proteinase inhibitor
Keywords: serine proteinase inhibitor
Deposited on 1993-03-29, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.212
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antithrombin III
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1atta_
  • Chain 'B':
    Compound: antithrombin III
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1attb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1attA (A:)
    vedvctakprdipvnpmciyrssekkategqgseqkipgatnrrvwelskanshfatafy
    qhladsknnndniflsplsistafamtklgacnntltqlmevfkfdtisektsdqihfff
    aklncrlyrkanksselvsanrlfgdksitfnetyqdisevvygaklqpldfkgnaeqsr
    ltinqwisnktegritdvippqaineftvlvlvntiyfkglwkskfspentrkelfykad
    gescsvlmmyqeskfryrrvaestqvlelpfkgdditmvlilpklektlakveqeltpdm
    lqewldeltetllvvhmprfriedsfsvkeqlqdmgledlfspeksrlpgivaegrsdly
    vsdafhkaflevneegseaaastvisiagrslnsdrvtfkanrpflvlirevalntiifm
    grvanpcvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1attA (A:)
    vedvctakprdipvnpmciyrategqgseqkipgatnrrvwelskanshfatafyqhlad
    sknnndniflsplsistafamtklgacnntltqlmevfkfdtisektsdqihfffaklnc
    rlyrkanksselvsanrlfgdksitfnetyqdisevvygaklqpldfkgnaeqsrltinq
    wisnktegritdvippqaineftvlvlvntiyfkglwkskfspentrkelfykadgescs
    vlmmyqeskfryrrvaestqvlelpfkgdditmvlilpklektlakveqeltpdmlqewl
    deltetllvvhmprfriedsfsvkeqlqdmgledlfspeksrlpgivaegrsdlyvsdaf
    hkaflevneegseaaastvisiagrslrvtfkanrpflvlirevalntiifmgrvanpcv
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1attB (B:)
    vedvctakprdipvnpmciyrssekkategqgseqkipgatnrrvwelskanshfatafy
    qhladsknnndniflsplsistafamtklgacnntltqlmevfkfdtisektsdqihfff
    aklncrlyrkanksselvsanrlfgdksitfnetyqdisevvygaklqpldfkgnaeqsr
    ltinqwisnktegritdvippqaineftvlvlvntiyfkglwkskfspentrkelfykad
    gescsvlmmyqeskfryrrvaestqvlelpfkgdditmvlilpklektlakveqeltpdm
    lqewldeltetllvvhmprfriedsfsvkeqlqdmgledlfspeksrlpgivaegrsdly
    vsdafhkaflevneegseaaastvisiagrslnsdrvtfkanrpflvlirevalntiifm
    grvanpcvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1attB (B:)
    kprdipvnpmciyrssqkipgatnrrvwelskanshfatafyqhladsknnndniflspl
    sistafamtklgacnntltqlmevfkfdtisektsdqihfffaklncrlyrkanksselv
    sanrlfgdksitfnetyqdisevvygaklqpldfkgnaeqsrltinqwisnktegritdv
    ippqaineftvlvlvntiyfkglwkskfspentrkelfykadgescsvlmmyqeskfryr
    rvaestqvlelpfkgdditmvlilpklektlakveqeltpdmlqewldeltetllvvhmp
    rfriedsfsvkeqlqdmgledlfspeksrlpgivaegrsdlyvsdafhkaflevneegse
    aaastvisiagrslnsdrvtfkanrpflvlirevalntiifmgrvanpcvd