PDB entry 1atk

View 1atk on RCSB PDB site
Description: crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor e-64
Deposited on 1996-12-19, released 1998-02-04
The last revision prior to the SCOP 1.61 freeze date was dated 1998-02-04, with a file datestamp of 1998-02-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.215
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1atk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1atk_ (-)
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm