PDB entry 1at9

View 1at9 on RCSB PDB site
Description: structure of bacteriorhodopsin at 3.0 angstrom determined by electron crystallography
Deposited on 1997-08-20, released 1998-09-16
The last revision prior to the SCOP 1.61 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: EDIF
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1at9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1at9_ (-)
    aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
    lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
    glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
    wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg