PDB entry 1ast

View 1ast on RCSB PDB site
Description: structure of astacin and implications for activation of astacins and zinc-ligation of collagenases
Deposited on 1993-04-21, released 1994-07-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.158
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1ast__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ast_ (-)
aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
hmlqtdanqinnlytnecsl