PDB entry 1ash

View 1ash on RCSB PDB site
Description: the structure of ascaris hemoglobin domain i at 2.2 angstroms resolution: molecular features of oxygen avidity
Deposited on 1995-01-06, released 1995-02-27
The last revision prior to the SCOP 1.59 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 2.15 Å
R-factor: 0.179
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1ash__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ash_ (-)
    anktrelcmkslehakvdtsnearqdgidlykhmfenypplrkyfksreeytaedvqndp
    ffakqgqkillachvlcatyddretfnaytrelldrhardhvhmppevwtdfwklfeeyl
    gkkttldeptkqawheigrefakeink