PDB entry 1as6

View 1as6 on RCSB PDB site
Description: structure of nitrite bound to oxidized alcaligenes faecalis nitrite reductase at cryo temperature
Class: oxidoreductase
Keywords: oxidoreductase, nitrite, copper, denitrification
Deposited on 1997-08-13, released 1998-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1as6a1, d1as6a2
  • Chain 'B':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1as6b1, d1as6b2
  • Chain 'C':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1as6c1, d1as6c2
  • Heterogens: CU, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1as6A (A:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1as6A (A:)
    taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
    ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
    katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfy
    vprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvliv
    hsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayv
    nhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1as6B (B:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1as6B (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1as6C (C:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1as6C (C:)
    taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
    ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
    katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfy
    vprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvliv
    hsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayv
    nhnlieafelgaaahfkvtgewnddlmtsvlapsg