PDB entry 1as6

View 1as6 on RCSB PDB site
Description: structure of nitrite bound to oxidized alcaligenes faecalis nitrite reductase at cryo temperature
Deposited on 1997-08-13, released 1998-02-25
The last revision prior to the SCOP 1.55 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1as6A (A:)
    taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
    ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
    katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfy
    vprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvliv
    hsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayv
    nhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1as6B (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1as6C (C:)
    taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
    ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
    katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfy
    vprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvliv
    hsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayv
    nhnlieafelgaaahfkvtgewnddlmtsvlapsg