PDB entry 1arp

View 1arp on RCSB PDB site
Description: Crystal structure of the fungal peroxidase from Arthromyces ramosus at 1.9 angstroms resolution: structural comparisons with the lignin and cytochrome C peroxidases
Class: peroxidase(donor:h2o2 oxidoreductase)
Keywords: peroxidase(donor:h2o2 oxidoreductase)
Deposited on 1993-06-18, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase
    Species: Penicillium janthinellum [TaxId:5079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1arpa_
  • Heterogens: CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1arpA (A:)
    qgpgggggsvtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaig
    fspaltaagqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqf
    atavgmsncpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdl
    laahslasqeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpge
    frmrsdallardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsa
    vsnnaapvipggltvddievscpsepfpeiatasgplpslapap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1arpA (A:)
    svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
    gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
    cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
    qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
    lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
    ipggltvddievscpsepfpeiatasgplpslapap