PDB entry 1aq8

View 1aq8 on RCSB PDB site
Description: structure of alcaligenes faecalis nitrite reductase reduced with ascorbate
Class: oxidoreductase
Keywords: oxidoreductase, nitrite, copper, denitrification
Deposited on 1997-08-07, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aq8a1, d1aq8a2
  • Chain 'B':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aq8b1, d1aq8b2
  • Chain 'C':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aq8c1, d1aq8c2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aq8A (A:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aq8A (A:)
    iaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtv
    pgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatk
    pgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfyvprd
    engkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvlivhsqa
    nrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayvnhnl
    ieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aq8B (B:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aq8B (B:)
    iaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtv
    pgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatk
    pgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfyvprd
    engkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvlivhsqa
    nrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayvnhnl
    ieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1aq8C (C:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aq8C (C:)
    iaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtv
    pgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatk
    pgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfyvprd
    engkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvlivhsqa
    nrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayvnhnl
    ieafelgaaahfkvtgewnddlmtsvlapsg