PDB entry 1aq2

View 1aq2 on RCSB PDB site
Description: phosphoenolpyruvate carboxykinase
Class: kinase
Keywords: kinase, transphosphorylating, p-loop, protein-ATP complex, nucleotide-triphosphate hydrolase, lyase, gluconeogenesis
Deposited on 1997-08-05, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aq2a1, d1aq2a2
  • Heterogens: MN, MG, ATP, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aq2A (A:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgek
    gdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepei
    ynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnl
    aiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aq2A (A:)
    nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
    grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
    fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
    glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdv
    avffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiyna
    irrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltad
    afgvlppvsrltadqtqyhflsgftaklagtiteptptfsacfgaaflslhptqyaevlv
    krmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaiptel
    pgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl