PDB entry 1apm

View 1apm on RCSB PDB site
Description: 2.0 angstrom refined crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with a peptide inhibitor and detergent
Class: transferase(phosphotransferase)
Keywords: transferase(phosphotransferase)
Deposited on 1993-01-18, released 1993-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 1993-04-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cAMP-DEPENDENT PROTEIN KINASE
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05132 (Start-349)
      • engineered (138)
    Domains in SCOP 1.75: d1apme_
  • Chain 'I':
    Compound: peptide inhibitor pki(5-24)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO3, OCT, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1apmE (E:)
    gnaaaakkgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
    khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvaggemfshlrrigrfaepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1apmE (E:)
    seqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhy
    amkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemf
    shlrrigrfaepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfak
    rvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyek
    ivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrk
    veapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

  • Chain 'I':
    No sequence available.