PDB entry 1apj

View 1apj on RCSB PDB site
Description: nmr study of the transforming growth factor beta binding protein-like domain (tb module/8-cys domain), nmr, 21 structures
Deposited on 1997-07-22, released 1998-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1apj__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1apj_ (-)
  saqdlrmsycyakfeggkcsspksrnhskqecccalkgegwgdpcelcptepdeafrqic
  pygsgiivgpddsa