PDB entry 1apb

View 1apb on RCSB PDB site
Description: a pro to gly mutation in the hinge of the arabinose-binding protein enhances binding and alters specificity: sugar-binding and crystallographic studies
Class: binding proteins
Keywords: binding proteins
Deposited on 1991-11-15, released 1992-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7600000000000002 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-arabinose-binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02924 (Start-305)
      • conflict (253)
    Domains in SCOPe 2.08: d1apba_
  • Heterogens: FCA, FCB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1apbA (A:)
    enlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakg
    fvictpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqe
    lykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndip
    gafdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsel
    skaqatgfygsllgspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelek
    kglggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1apbA (A:)
    nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
    victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
    ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
    afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
    kaqatgfygsllgspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
    glggk