PDB entry 1ap9

View 1ap9 on RCSB PDB site
Description: x-ray structure of bacteriorhodopsin from microcrystals grown in lipidic cubic phases
Deposited on 1997-07-26, released 1998-09-16
The last revision prior to the SCOP 1.61 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.2582
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1ap9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ap9_ (-)
    rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl
    tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga
    ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp
    vvwligsegagivplnietllfmvldvsakvgfglillr