PDB entry 1ap7

View 1ap7 on RCSB PDB site
Description: p19-ink4d from mouse, nmr, 20 structures
Deposited on 1997-07-25, released 1998-09-16
The last revision prior to the SCOP 1.59 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1ap7__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ap7_ (-)
gsmlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspaval
ellkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireg
hssvvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm