PDB entry 1aoh

View 1aoh on RCSB PDB site
Description: single cohesin domain from the scaffolding protein cipa of the clostridium thermocellum cellulosome
Class: structural protein
Keywords: cellulosome subunit, b-barrel, cellulose degradation, structural protein
Deposited on 1997-07-03, released 1998-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosomal-scaffolding protein A
    Species: Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) [TaxId:203119]
    Gene: cipA, Cthe_3077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aoha_
  • Chain 'B':
    Compound: Cellulosomal-scaffolding protein A
    Species: Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) [TaxId:203119]
    Gene: cipA, Cthe_3077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06851 (1-146)
      • expression tag (0)
    Domains in SCOPe 2.08: d1aohb1, d1aohb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1aohA (A:)
tdldavrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgeli
vdpnptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvik
fvevggfanndlveqktqffdggvnvg

    Sequence, based on observed residues (ATOM records): (download) 
    >1aohA (A:)
avrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgelivdpn
ptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvikfvev
ggfanndlveqktqffdggvnvg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aohB (B:)
tdldavrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgeli
vdpnptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvik
fvevggfanndlveqktqffdggvnvg