PDB entry 1ao3

View 1ao3 on RCSB PDB site
Description: a3 domain of von willebrand factor
Class: collagen-binding
Keywords: collagen-binding, von willebrand, cell adhesion
Deposited on 1997-07-16, released 1998-07-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.158
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ao3a_
  • Chain 'B':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ao3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ao3A (A:)
    csqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpw
    nvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsv
    dsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgn
    sflhklc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ao3B (B:)
    csqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpw
    nvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsv
    dsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgn
    sflhklc