PDB entry 1an8

View 1an8 on RCSB PDB site
Description: crystal structure of the streptococcal superantigen spe-c
Class: bacterial superantigen
Keywords: bacterial superantigen, toxin
Deposited on 1997-06-27, released 1998-04-29
The last revision prior to the SCOP 1.73 freeze date was dated 1998-04-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptococcal pyrogenic exotoxin c
    Species: Streptococcus pyogenes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1an8a1, d1an8a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1an8A (A:)
    dskkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeas
    qkfkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnki
    ilekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegt
    rsdifakykdnriinmknfshfdiylek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1an8A (A:)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnkiil
    ekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrs
    difakykdnriinmknfshfdiylek