PDB entry 1an8

View 1an8 on RCSB PDB site
Description: crystal structure of the streptococcal superantigen spe-c
Deposited on 1997-06-27, released 1998-04-29
The last revision prior to the SCOP 1.59 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1an8_ (-)
    kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
    fkrddhvdvfglfyilnshtgeyiyggitpaqnnkvnhkllgnlfisgesqqnlnnkiil
    ekdivtfqeidfkirkylmdnykiydatspyvsgrieigtkdgkheqidlfdspnegtrs
    difakykdnriinmknfshfdiylek