PDB entry 1alc

View 1alc on RCSB PDB site
Description: refined structure of baboon alpha-lactalbumin at 1.7 angstroms resolution. comparison with c-type lysozyme
Deposited on 1989-08-14, released 1989-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1990-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1alc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1alc_ (-)
    kqftkcelsqnlydidgygrialpelictmfhtsgydtqaivendesteyglfqisnalw
    ckssqspqsrnicditcdkflddditddimcakkildikgidywiahkalctekleqwlc
    ek