PDB entry 1akl

View 1akl on RCSB PDB site
Description: alkaline protease from pseudomonas aeruginosa ifo3080
Deposited on 1995-09-16, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1akl_ (-)
    grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
    fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
    dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
    tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
    aiqklyganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqn
    qkinlnekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilyg
    glgadqlwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyv
    dafagkagqailsydaaskagslaidfsgdahadfainligqatqadivv