PDB entry 1ak4

View 1ak4 on RCSB PDB site
Description: human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid
Class: Viral protein/isomerase
Keywords: CAPSID, HIV-1, CYCLOPHILIN A, ISOMERASE, ROTAMASE COMPLEX (CAPSID PROTEIN/CYCLOSPORIN), Viral protein/isomerase COMPLEX
Deposited on 1997-05-28, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.238
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ak4a_
  • Chain 'B':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ak4b_
  • Chain 'C':
    Compound: hiv-1 capsid
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ak4c_
  • Chain 'D':
    Compound: hiv-1 capsid
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ak4d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ak4A (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ak4B (B:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ak4B (B:)
    nptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfmc
    qggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewl
    dgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ak4C (C:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ak4D (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmy