PDB entry 1ajh

View 1ajh on RCSB PDB site
Description: photoproduct of carbonmonoxy myoglobin at 40 k
Deposited on 1997-05-02, released 1997-11-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.171
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ajh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ajh_ (-)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg