PDB entry 1aiu

View 1aiu on RCSB PDB site
Description: human thioredoxin (d60n mutant, reduced form)
Deposited on 1997-04-25, released 1997-07-07
The last revision prior to the SCOP 1.71 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1aiu__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aiu_ (-)
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvn
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv