PDB entry 1aiu

View 1aiu on RCSB PDB site
Description: human thioredoxin (d60n mutant, reduced form)
Class: electron transport
Keywords: oxidoreductase, dimer, thioredoxin, d60n, electron transport, redox-active center
Deposited on 1997-04-25, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (1-104)
      • engineered (59)
    Domains in SCOPe 2.07: d1aiua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aiuA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvn
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv