PDB entry 1aip

View 1aip on RCSB PDB site
Description: ef-tu ef-ts complex from thermus thermophilus
Deposited on 1997-04-22, released 1997-10-22
The last revision prior to the SCOP 1.57 freeze date was dated 1999-06-21, with a file datestamp of 1999-06-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.216
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aipA (A:)
    kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
    rrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrrtvvtgvemhrktlqegiagdnvgvllrgvsreevergqvlakpg
    sitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipA (A:)
    kphvnvgtighvdhgkttltaaltyvtaaenptahveyetakrhyshvdcpghadyiknm
    itgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlvem
    evrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt
    pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvem
    hrktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkkeeggrht
    gffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrfairegg
    rtvgagvvtkile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aipB (B:)
    kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
    rrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrrtvvtgvemhrktlqegiagdnvgvllrgvsreevergqvlakpg
    sitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipB (B:)
    kphvnvgtighvdhgkttltaaltyvtaaenptahveyetakrhyshvdcpghadyiknm
    itgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlvem
    evrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt
    pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvem
    hrktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkkeeggrht
    gffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrfairegg
    rtvgagvvtkile
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aipC (C:)
    sqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegiig
    hyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeeleke
    rqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiakig
    enivvrrfcrfelga
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aipD (D:)
    sqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegiig
    hyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeeleke
    rqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiakig
    enivvrrfcrfelga
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1aipE (E:)
    kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
    rrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrrtvvtgvemhrktlqegiagdnvgvllrgvsreevergqvlakpg
    sitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipE (E:)
    kphvnvgtighvdhgkttltaaltyvtaaenpahveyetakrhyshvdcpghadyiknmi
    tgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlveme
    vrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyiptp
    vrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvemh
    rktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkkeeggrhtg
    ffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrfaireggr
    tvgagvvtkile
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1aipF (F:)
    kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
    eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
    pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
    rrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvk
    vgdeveivglapetrrtvvtgvemhrktlqegiagdnvgvllrgvsreevergqvlakpg
    sitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnv
    tftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aipF (F:)
    kphvnvgtighvdhgkttltaaltyvtaaenpahveyetakrhyshvdcpghadyiknmi
    tgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlveme
    vrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyiptp
    vrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvemh
    rktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkkeeggrhtg
    ffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrfaireggr
    tvgagvvtkile
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aipG (G:)
    sqmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegiig
    hyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeeleke
    rqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiakig
    enivvrrfcrfelga
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aipH (H:)
    qmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadrearegiigh
    yihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeipaeeleker
    qiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliqqaiakige
    nivvrrfcrfelga