PDB entry 1aij

View 1aij on RCSB PDB site
Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state
Class: photosynthetic reaction center
Keywords: photosynthetic reaction center, integral membrane protein, charge neutral
Deposited on 1997-04-18, released 1997-10-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: photosynthetic reaction center (h subunit)
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aijh1, d1aijh2
  • Chain 'L':
    Compound: photosynthetic reaction center (l subunit)
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aijl_
  • Chain 'M':
    Compound: photosynthetic reaction center (m subunit)
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aijm_
  • Chain 'R':
    Compound: photosynthetic reaction center (l subunit)
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aijr_
  • Chain 'S':
    Compound: photosynthetic reaction center (m subunit)
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aijs_
  • Chain 'T':
    Compound: photosynthetic reaction center (h subunit)
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aijt1, d1aijt2
  • Heterogens: FE2, BCL, BPH, U10, LDA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1aijH (H:)
    mvgvtafqnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aijH (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    vvaaml
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aijL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1aijM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aijM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    h
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aijR (R:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1aijS (S:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aijS (S:)
    yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
    glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
    fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
    ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
    taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1aijT (T:)
    mvgvtafqnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aijT (T:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    vvaaml