PDB entry 1ahd

View 1ahd on RCSB PDB site
Description: determination of the nmr solution structure of an antennapedia homeodomain-dna complex
Deposited on 1993-04-02, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'P':
  Domains in SCOP 1.55: d1ahdp_

PDB Chain Sequences:

• Chain 'P':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ahdP (P:)
  mrkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkke
  nktkgepg