PDB entry 1agw

View 1agw on RCSB PDB site
Description: crystal structure of the tyrosine kinase domain of fibroblast growth factor receptor 1 in complex with su4984 inhibitor
Class: protein kinase
Keywords: protein kinase, transferase, tyrosine-protein kinase, ATP-binding, phosphorylation, inhibitor
Deposited on 1997-03-25, released 1998-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fgf receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agwa_
  • Chain 'B':
    Compound: fgf receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (32)
      • engineered (32)
    Domains in SCOPe 2.07: d1agwb_
  • Heterogens: SU2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1agwA (A:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agwA (A:)
    elpedprwelprdrlvlgkplgqvvlaeaiglpnrvtkvavkmlksdatekdlsdlisem
    emmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeqlsskdlvsca
    yqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkttngrlpv
    kwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsn
    ctnelymmmrdcwhavpsqrptfkqlvedldrivalts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1agwB (B:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agwB (B:)
    seyelpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekd
    lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdl
    vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgladyykkgrlpvkwmap
    ealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnel
    ymmmrdcwhavpsqrptfkqlvedldrivalt