PDB entry 1agi

View 1agi on RCSB PDB site
Description: crystal structure of bovine angiogenin at 1.5 angstroms resolution
Deposited on 1995-01-06, released 1996-04-03
The last revision prior to the SCOP 1.55 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1agi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1agi_ (-)
    aqddyryihfltqhydakpkgrndeycfnmmknrrltrpckdrntfihgnkndikaiced
    rngqpyrgdlrisksefqitickhkggssrppcrygatedsrvivvgcenglpvhfdesf
    itprh