PDB entry 1afw

View 1afw on RCSB PDB site
Description: the 1.8 angstrom crystal structure of the dimeric peroxisomal thiolase of saccharomyces cerevisiae
Class: thiolase
Keywords: thiolase, fatty acid metabolism
Deposited on 1997-03-15, released 1997-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-ketoacetyl-coa thiolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1afwa1, d1afwa2
  • Chain 'B':
    Compound: 3-ketoacetyl-coa thiolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1afwb1, d1afwb2
  • Heterogens: MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1afwA (A:)
    knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
    ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
    diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
    defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikd
    rgtttagnasqvsdgvagvllarrsvanqlnlpvlgryidfqtvgvppeimgvgpayaip
    kvleatglqvqdidifeineafaaqalycihklgidlnkvnprggaialghplgctgarq
    vatilrelkkdqigvvsmcigtgmgaaaifike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afwA (A:)
    knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
    ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
    diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
    defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafigt
    ttagnasqvsdgvagvllarrsvanqlnlpvlgryidfqtvgvppeimgvgpayaipkvl
    eatglqvqdidifeineafaaqalycihklgidlnkvnprggaialghplgctgarqvat
    ilrelkkdqigvvsmcigtgmgaaaifike
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afwB (B:)
    knsllekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnl
    ieevacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqi
    diglalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdq
    defaansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikd
    rgtttagnasqvsdgvagvllarrsvanqlnlpvlgryidfqtvgvppeimgvgpayaip
    kvleatglqvqdidifeineafaaqalycihklgidlnkvnprggaialghplgctgarq
    vatilrelkkdqigvvsmcigtgmgaaaifike