PDB entry 1afv

View 1afv on RCSB PDB site
Description: hiv-1 capsid protein (p24) complex with fab25.3
Deposited on 1997-03-14, released 1997-08-20
The last revision prior to the SCOP 1.61 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.217
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvA (A:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvB (B:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsil
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvH (H:)
    qvqlqqpgsvlvrpgasvklsckasgytftsswihwakqrpgqglewigeihpnsgntny
    nekfkgkatltvdtssstayvdlssltsedsavyycarwrygspyyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvK (K:)
    qvqlqqpgsvlvrpgasvklsckasgytftsswihwakqrpgqglewigeihpnsgntny
    nekfkgkatltvdtssstayvdlssltsedsavyycarwrygspyyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvL (L:)
    divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnlgs
    gvparfsgsgsgtdfslnihpmeeedtamyfcqqskevpltfgagtkvelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afvM (M:)
    divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppklliyaasnlgs
    gvparfsgsgsgtdfslnihpmeeedtamyfcqqskevpltfgagtkvelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne