PDB entry 1af0

View 1af0 on RCSB PDB site
Description: serratia protease in complex with inhibitor
Deposited on 1997-03-20, released 1998-03-25
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-25, with a file datestamp of 1998-03-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1af0A (A:)
    attgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfs
    fpdykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnys
    qdrpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheigha
    lglshpgdynagegdptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaa
    iqhlyganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanq
    rinlneksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfgg
    ggadelwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffdkeansssfihfvd
    hfsgtageallsynassnvtdlsvnigghqapdflvkivgqvdvatdfiv