PDB entry 1aew

View 1aew on RCSB PDB site
Description: l-chain horse apoferritin
Class: iron storage
Keywords: iron storage, multigene family
Deposited on 1997-02-26, released 1997-09-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1aewa_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aewA (A:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aewA (A:)
    sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
    aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
    dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl