PDB entry 1ae6

View 1ae6 on RCSB PDB site
Description: igg-fab fragment of mouse monoclonal antibody ctm01
Class: immunoglobulin
Keywords: immunoglobulin, fab fragment, humanisation
Deposited on 1997-03-06, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg ctm01 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01869 (0-216)
      • conflict (12)
      • conflict (34)
      • conflict (36)
      • conflict (39)
      • conflict (42)
      • conflict (51)
      • conflict (90)
      • conflict (98)
      • insertion (100-103)
      • conflict (103)
      • conflict (119)
      • conflict (124)
      • conflict (133-137)
      • conflict (139)
      • conflict (141)
      • conflict (158)
      • conflict (190)
      • conflict (193-194)
      • conflict (197-199)
    Domains in SCOPe 2.07: d1ae6h1, d1ae6h2
  • Chain 'L':
    Compound: igg ctm01 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VCI6 (0-218)
      • conflict (6-8)
      • conflict (10)
      • conflict (13-14)
      • conflict (16-18)
      • conflict (26)
      • conflict (26)
      • conflict (34)
      • conflict (36)
      • conflict (38)
      • conflict (43)
      • conflict (49)
      • conflict (54-55)
      • conflict (58-59)
      • conflict (74)
      • conflict (78-79)
      • conflict (87)
      • conflict (93)
      • conflict (95-98)
      • conflict (100)
      • conflict (104)
      • conflict (110)
      • conflict (216)
    Domains in SCOPe 2.07: d1ae6l1, d1ae6l2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ae6H (H:)
    qiqlqqsgpelvkpgasvkisckasgytftdyyinwmkqkpgqglewigwidpgsgntky
    nekfkgkatltvdtssstaymqlssltsedtavyfcarekttyyyamdywgqgtsvtvsa
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkiv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ae6L (L:)
    divmtqaapsvpvtpgeslsiscrssksllhsngdtflywflqrpgqspqlliyrmsnla
    sgvpdrfsgsgsgtaftlrvsrveaedvgvyycmqhleypftfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec